DPCstruct | MC21789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 177 ± 24 aa |
| Standard deviation of domain lengths | 24.25 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 25.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9WWQ7 | 46-207 | LRRPVTVVETRRRLFNRLGLFIPTPPPDGCKAKQAQQSPKTHHTLKGRLNDAHAIYECGDTDSETVSSASTTQSSQSGVRFDPTVTI… |
| A0A7R9Z5G3 | 50-220 | PVHHAPTPKPFLSPVTDALASSRSNPGTVATQQVPLKYDRSKVDDDVVLSSTPPQSSPPKQEPASGGGKASSPSRKSRVLSFDDSVS… |
| A0A7S1UW74 | 2-206 | None |
| K0R716 | 121-354 | None |
| A0A7R9W123 | 1-154 | None |
| A0A7R9WU08 | 14-185 | None |
| A0A1E7FV21 | 1-155 | None |
| A0A1E7FUY7 | 28-227 | None |
| A0A7S2RYY1 | 90-312 | None |
| A0A6U3X9L5 | 101-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.