DPCstruct | MC21788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 119 ± 12 aa |
| Standard deviation of domain lengths | 12.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0CDG9 | 10-114 | GRQYSDGSTLGLHSKHFIVDDRCCYIGSQNLYLCDLAEWGVVIDHAETTRSIKAQYWDPMWKCSYREDDCEVRNVMDGLSIRRVAAT… |
| A0A7R9Z3B7 | 5-119 | GSTWEDGMSMGMHAKHFIVDDAACYIGSQNLYVCDLAEWGVVIDSAETTQKFMEEYWNPMWKYSYTGEDCDVQEVMDGLDIDRDGED… |
| A0A448ZNU7 | 86-210 | None |
| B5YN52 | 446-590 | None |
| A0A448ZNX4 | 457-576 | None |
| A0A7S2S8X3 | 2-139 | None |
| A0A813E187 | 237-340 | None |
| A0A7S1ZR72 | 161-286 | None |
| A0A7S1AYC7 | 111-224 | None |
| A0A7S1BU82 | 326-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.