DPCstruct | MC21787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 131 ± 33 aa |
| Standard deviation of domain lengths | 32.56 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 74.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 32.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0LNS7 | 165-281 | CEEGEGDCDSDSDCATGLSCYLNVGADFGLDADTDVCAECPPDSMLGHVDFCSPDCQCSQGEGDCDTNADCADGLRCFLNVGTDFGY… |
| A0A7R9Z1H7 | 132-279 | TPPSPTTTTTTTTTTTTTTAGGMKPLTVKSNNLGYQQYGECEGDCDEDSDCIGDLVCFQRSTAEGGIPVPGCSGTYPASYTTDFCFQ… |
| A0A7S2EFF7 | 1-85 | None |
| A0A7S1VAJ4 | 47-272 | None |
| A0A7S1VD11 | 233-319 | None |
| A0A7S2MWX8 | 6-106 | None |
| A0A7R9ZM30 | 3-101 | None |
| B7GB28 | 243-335 | None |
| A0A7S2HE95 | 7-105 | None |
| A0A850BLM7 | 266-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.