DPCstruct | MC21785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 122 ± 17 aa |
| Standard deviation of domain lengths | 16.68 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q4GKT0 | 1-126 | MQTLRPCAIVCGTDAVASAVALRLVEAGYTVLLAADAAPAVVPCGESFAAAMKDGEASLDGVRCRRVADAAEWLRDGAHDIACCAQP… |
| A0A6V8PAY5 | 87-207 | ILVLIKGAGDLATGVAVSLHKCGMKVIMIEIAQPRAIRGTVALAEAIYEGQMEVEEVRAIRAARFQDAEEIIGKGHIPIFVDEKGEA… |
| A0A7C4U4L3 | 2-131 | None |
| G8QT59 | 337-460 | None |
| A0A2X3JBJ9 | 50-157 | None |
| A0A1V5CWC7 | 178-305 | None |
| A0A7X6CU75 | 514-639 | None |
| A0A5J4V1P6 | 1-144 | None |
| A0A534RKF6 | 1-126 | None |
| A0A1N7IJ55 | 36-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.