DPCstruct | MC21784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 159 ± 21 aa |
| Standard deviation of domain lengths | 20.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3JIE8 | 135-306 | MGVTLTAAIGGADMPVVITVLNSYSGWALCAEGFMLNNNLMTIVGALIGSSGAILSYIMCVAMNRSLPNVILGGYGTSSYAGGKAKE… |
| A0A5E7V817 | 2-151 | GVLIIIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNTSMLIIAGSLVGSSGAILSYVMCKAMNRSFFDVLLGGFGNTSDAGAAAGSK… |
| A0A835XZX3 | 792-970 | None |
| A0A837AL08 | 88-271 | None |
| A0A844VZ52 | 8-143 | None |
| A0A1U7JK35 | 23-155 | None |
| A0A5J4X2R3 | 43-205 | None |
| G0QVQ6 | 166-360 | None |
| A0A7S3FG00 | 170-331 | None |
| A0A2X1B6E0 | 96-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.