DPCstruct | MC21780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 6.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07809 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5N4A4 | 118-197 | ASDEPCGLRGAVIQVHLETGSAVRALGSIVPDRSVTPTFELSVVFKADQDNWPSLRHLFGKVLKLSPGFRLVKRKLYSSA |
| A0A820FH48 | 1-97 | MSAEEPFGIMGAQIKIKLTLLSSNITNTITKYLPVIRINPKQKTTFEIEIDLHEDTKVFTLRRMLPRMKMFQQIKERSPLYVSPRCL… |
| T1E2W8 | 156-237 | None |
| A0A182VL46 | 113-194 | None |
| A0A3S1A8X1 | 113-202 | None |
| A0A1A9WG84 | 319-402 | None |
| A0A182J3T3 | 207-288 | None |
| V4B155 | 44-138 | None |
| A0A815ZX66 | 53-149 | None |
| A0A653BND3 | 284-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.