DPCstruct | MC2178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 141 ± 20 aa |
| Standard deviation of domain lengths | 20.33 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 35.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q7RMQ0 | 1-174 | CENFDMLIEQYPDELNNSEECDIHNIDGIEEYCPNGNSGNKCITELDKINAACLWLLNQNIANRIDDLSNEHVKAFIIYIMIWLNYM… |
| A0A1D3L6J7 | 5-137 | ICQNFNSVCIYFPDALKNDGNYNFLSDGQQFKQYCTNNKCDNNLEKINSACLYLFNAFFGSSYSVRDNANSNIDVVDYIITWLSYML… |
| Q7RRY8 | 28-139 | None |
| V7PUG8 | 6-160 | None |
| Q7RKY9 | 132-264 | None |
| Q7RDL9 | 2-150 | None |
| A0A4V0K7Y9 | 1-138 | None |
| A0A4V0K298 | 1-131 | None |
| V7PVD1 | 48-179 | None |
| V7PV83 | 5-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.