DPCstruct | MC21779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 115 ± 6 aa |
| Standard deviation of domain lengths | 5.78 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813XTY4 | 473-588 | TTDEQTVTGVLNRHNWTDIGAVIDVTGSMSGCYAQINQWVALSHSNKLVQCFVFFNDGDDTPDADKVIGSTGGLYGVYTREGMAKVL… |
| A0A819SPL0 | 2-104 | VAVVDVTGSMQPCAAAVYKWLKLSYDKLNLIKYYVFFNDGDNKADALKVIGSTGGIYGTATTNLNTTLAVMQAAMKNGNGGDGPEND… |
| A0A2H0G6H7 | 255-371 | None |
| A0A6C1S5V6 | 381-495 | None |
| L7W5M0 | 289-410 | None |
| A0A2E4EBB0 | 167-284 | None |
| A0A4Q5WP73 | 262-371 | None |
| A0A6N4QCN9 | 180-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.