DPCstruct | MC21778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 120 ± 9 aa |
| Standard deviation of domain lengths | 9.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.89 |
| Pfam Score | 92.95 |
| Assigned Pfam label(s) | CL0361- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E6EQA8 | 77-196 | YLKIKYLDKVTPEKFDGISADDVEKPIAEMMPPGYLTNIDDFVSSLEKEHLFRPPGEKVNSYQIHKDNCERTFEVFKASVLSPGFKN… |
| A0A819BB39 | 1-139 | MDLNEQANEVIAFELIRSEKYVNNEADDLIESLNQWIPSTTTTTTTTNLDLFLSKLKNENEYAPFGEQILSCELNGETSTSYLINRV… |
| A0A3M0L0M5 | 79-195 | None |
| A0A2P2HWI4 | 41-152 | None |
| I1BH38 | 83-193 | None |
| A0A0D8YEN8 | 75-202 | None |
| A0A4Y7LZS8 | 74-193 | None |
| A0A820FXQ9 | 42-165 | None |
| A0A0R3QB64 | 43-163 | None |
| A0A556U4R6 | 353-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.