DPCstruct | MC21774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 334 ± 43 aa |
| Standard deviation of domain lengths | 43.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U7KSD5 | 1-349 | MRRVISFSVALLVLLFGARSTPMQGEHDEGSSSSFPSSESTGFDWQEHQYPQAWSPDPVQQLWSAETPREDSLGHERAAGGATSELS… |
| E6ZZM3 | 1-284 | MDHLHTTYYSPHGLHDGVGHSTTAPLGEMWHGEMWQNMATSSQPSSSTPDTLSQADIDFVNNVLVDPYDEQQVAEDVVEPDVNTARA… |
| Q4P9A0 | 41-358 | None |
| A0A1K0G1X6 | 66-388 | None |
| A0A127ZKJ2 | 41-359 | None |
| A0A2N8UDR2 | 1-353 | None |
| M9MB82 | 259-647 | None |
| R9NWW4 | 133-544 | None |
| R9NX07 | 310-588 | None |
| A0A0F7SBE0 | 311-702 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.