DPCstruct | MC21772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 70 ± 9 aa |
| Standard deviation of domain lengths | 9.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3QL65 | 38-94 | IGGTTLYAQNCSGCHGNIATSTKLGRSSYEIQTAINSNIGNMGGLNYLTAAQVEAIA |
| A0A2N6EVA4 | 603-673 | GSVDEGCDIVNDGVVLYENLCASCHGELSDSKICGKDAENIMDAIIDNKGGMSAHSPLTDTQLKLIADALS |
| A0A4Q6E031 | 257-322 | None |
| A0A521XWH3 | 536-593 | None |
| A0A5E4HL04 | 118-203 | None |
| A0A4Q6CDV6 | 206-277 | None |
| A0A2D5ZZC8 | 155-225 | None |
| A0A3N5KZ35 | 501-579 | None |
| A0A643GGD1 | 76-134 | None |
| A0A6F9WUQ0 | 414-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.