DPCstruct | MC21770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 176 ± 27 aa |
| Standard deviation of domain lengths | 26.84 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 64.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B2RRN5 | 1-140 | DFEPGGQVFSRGEWLTIIRVNKSNGTVSSVTTPNYSFLGYSGTMKVTPDRITDYKAPSAEEAAVASQAAKRPPVVNYPGEGFREMTK… |
| A0A7B5R750 | 1-176 | ERQIQHQQRWVNHYQNRLIYERAMLDESGGVVTRTQDFEPGGQVFSRGEWLTIIRVNKSNGAVSSVTTPNYSFLGYSGTMKVTPDRI… |
| A0A839L8Y0 | 2-125 | None |
| A0A157SSL4 | 262-431 | None |
| A0A827SQW3 | 26-226 | None |
| A0A7B9GQP9 | 88-288 | None |
| A0A271QLH7 | 1-177 | None |
| A0A7B6SV77 | 121-321 | None |
| A0A0F2N9Y6 | 251-388 | None |
| A0A376L5C6 | 59-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.