DPCstruct | MC21769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 7.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 57.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830WKS9 | 5-60 | APAVYVGTWHKYNCGSIAGRWFDLTTFDDERDFFAACRALHQDEADPELMFQDYEG |
| A0A7B3JS25 | 5-62 | APAVYVGTWHKYNCGSIAGRWFDLTTFDDERDFFAACRALHQDETDPELMFQDYEGFP |
| A0A2V3A1Y5 | 1-74 | None |
| A0A173VWX8 | 4-65 | None |
| A0A246G7U5 | 1-60 | None |
| A0A1H6TVX4 | 1-69 | None |
| A0A8B0SRQ2 | 127-191 | None |
| A0A1N6X916 | 1-76 | None |
| A0A6L5XDL3 | 58-115 | None |
| A0A1N7MFI2 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.