DPCstruct | MC21768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 126 ± 23 aa |
| Standard deviation of domain lengths | 22.72 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06986 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5HCZ2 | 3-84 | FVGSYCKSKVLGACIEKREAYCCFNSPLSRIVQEQVRPQLGMSFGSPKNPQCGGIPLDKIAEIDWSKVNLDEWLGILQQNGK |
| A0A7A9LQV7 | 93-248 | RAFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKALAKAKSNKLTVSVGEFCSKKVLGVCLEKKRSYCQFDSKLAQIVQQQ… |
| A0A1I4I2R4 | 17-136 | None |
| A0A2H1P8V5 | 52-144 | None |
| A0A5N7WE54 | 135-283 | None |
| Q7VJH3 | 576-701 | None |
| A0A2N3DZA1 | 461-610 | None |
| A0A5J4L7B1 | 24-155 | None |
| A0A1H7A897 | 211-317 | None |
| A0A3D8GXG5 | 369-480 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.