DPCstruct | MC21766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 155 ± 29 aa |
| Standard deviation of domain lengths | 29.34 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.43 |
| Pfam Score | 98.84 |
| Assigned Pfam label(s) | PF08617- PF04045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218NLL0 | 12-153 | LLKHSFAFRLYKRKSSFEIIFDQADRFNKQNAKKYEFVLLLKPYLSDDYPELVFAYINACLSFKNKTNRSSSIPLEMLIYLSGAKSI… |
| A0A2C5WTZ6 | 5-170 | LETIALEHLPATHTLHMVLFQDVKNAEFLHKQLLARNAEFEYALVDAGIATSRHQIMAAVYKAASSDLNGTLRTPNVHSEIVNSLNP… |
| A0A7M4EUG4 | 1-117 | None |
| A0A2A2KLA4 | 26-138 | None |
| A0A109FMY2 | 261-422 | None |
| L0AZK8 | 29-183 | None |
| A0A482VBL3 | 283-437 | None |
| A0A146HJ47 | 4-196 | None |
| A0A6A6LCF9 | 159-311 | None |
| A0A1X6PHL4 | 11-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.