DPCstruct | MC21765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 111 ± 6 aa |
| Standard deviation of domain lengths | 5.84 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G3IMJ4 | 57-165 | DKYSQSETDEIKKVERKLKLWSKEERQKNINSRILNEFLKLKKYGNKDITETDIQNKLLDVEDFKSNFDQMKNIAEKNNGKIFEQNG… |
| A0A120DGP0 | 37-146 | AQAPKTLSEEYLDEKDKVRHRLERWALHQDQINSRILNAYLTLERKGYSPITITMLQNQLLDMKTFLPNFNQMKSIAPHNHAKVFDV… |
| A0A1E5AKU1 | 3-112 | None |
| A0A376GK01 | 1-104 | None |
| A0A3D5BHS5 | 36-139 | None |
| A0A7Z9QIV9 | 60-172 | None |
| A0A1W1CWV8 | 50-153 | None |
| R9C8J0 | 49-172 | None |
| A0A7K1KP18 | 154-267 | None |
| A0A2G6QV28 | 17-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.