DPCstruct | MC21764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 243 ± 49 aa |
| Standard deviation of domain lengths | 48.56 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 38.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9VE74 | 1-162 | MEDAKDPCFWSRICMHSIAKLSKEATTFRRVMESLFRHFDDTNSWLSKNGLALCVLLDMQMFMENSGQNINLTISILVTHLGHKAVL… |
| A0A5D3CGP5 | 1-230 | MGEFSNISAEFDNVISVVLDNYGDVESTSRQDTQDATALVTHPREHITRMCSWRMIVTEKGEIIVSLEDAQNPQFWSRVCLRNIAKL… |
| A0A5D2HWY4 | 219-416 | None |
| A0A2U1M0V6 | 418-649 | None |
| A0A5N5FB46 | 1-180 | None |
| A0A1D6MMM9 | 3-252 | None |
| A0A7J0F332 | 168-454 | None |
| A0A453SPI0 | 38-280 | None |
| A0A445IMJ6 | 168-469 | None |
| A0A2I0I9M4 | 47-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.