DPCstruct | MC21761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 54 ± 4 aa |
| Standard deviation of domain lengths | 4.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 61.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05996 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P3Z8R1 | 59-116 | LLRNFLFHGIVQLGSKNFLDYFPEYRCEDGTINERRTIIGKSFENRPWDTRGEFIGSF |
| A0A5D3C8Z0 | 1-53 | MFNGIDELESKRFLNYFPEFRCEHGTINTKRSMAGKSYEHRPWDERGVTCTLD |
| A0A4S4EQA6 | 126-183 | None |
| A0A7C8YV50 | 159-213 | None |
| A0A822YDP2 | 136-180 | None |
| A0A7J6VF92 | 9-59 | None |
| B4FHE6 | 94-150 | None |
| A0A2N9J8K9 | 60-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.