DPCstruct | MC2176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 121 ± 12 aa |
| Standard deviation of domain lengths | 11.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Y9UTV3 | 74-193 | INKRFYNPRENINWILIRFRHRVSQLRKKKLKYKNHSKVALRFRLTKFGWERLQSGRNASKRNLSVKKYNEKMKIKYVSRDDIKKFK… |
| A0A7J6KEG8 | 233-352 | VFSQSRGYKPVIDWVKNRINARMRQYRKRSLKKKNHSKVIQRFKLTRFGWQRLRSGRNGEKENLTHKQLKRTMGYTFVSRDDLWKFR… |
| A0A0G4F520 | 141-266 | None |
| F0VA67 | 4-120 | None |
| A0A7J6LS19 | 47-173 | None |
| A0A1Q9CFR8 | 413-535 | None |
| A0A7J6PSN7 | 44-177 | None |
| A0A812KZ24 | 3-94 | None |
| A0A812PNM5 | 12-134 | None |
| A0A812UKZ3 | 152-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.