DPCstruct | MC21759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 106 ± 8 aa |
| Standard deviation of domain lengths | 7.51 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 52.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7KN82 | 27-127 | IEDELVKKIQPWKKQITLRGLITSFVIGSLYSIIIMKLNLTTGITQNLNVPAALVAFVVIRSWTKLLNKFGLSSTPFTPQENTIIQT… |
| A0A5D3C5R3 | 1-110 | MVEELMSVERIFEAQEVPSWQNQLTVRAFAMSFGLSVLFTFIVMKLNLTTGIIPSLNVSAGFLGFFFVETWTKLLKKSGLLKQPFTR… |
| A0A835QRI8 | 50-156 | None |
| A0A453CJJ4 | 27-125 | None |
| A0A3L6EVL2 | 212-312 | None |
| A0A317Y6D5 | 172-272 | None |
| A0A2I0I1Z4 | 9-110 | None |
| A0A1D6QUQ4 | 1-123 | None |
| A0A7J7MM81 | 1-117 | None |
| A0A6A6M9H1 | 13-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.