DPCstruct | MC21756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 52 ± 3 aa |
| Standard deviation of domain lengths | 3.05 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 53.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A829BAZ1 | 127-178 | STAGLVYISCFPDRKTMRKYLADIAWETEVWCADAPSHMVHFNGERFLGPYD |
| A0A512TP99 | 4-55 | NVTAGKIYVTAFLDMKTFKKFSESLAWETEIWIADFPEHMINMNGDKFLGPR |
| A0A1F9BAN9 | 23-73 | None |
| A0A6L8FY67 | 567-616 | None |
| A0A5B3GK60 | 37-94 | None |
| A0A022PGW2 | 22-73 | None |
| A0A2X2IE16 | 73-124 | None |
| A0A3R9PIG2 | 327-372 | None |
| Q8YQW1 | 489-540 | None |
| A0A1G1GIS1 | 91-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.