DPCstruct | MC21755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 63 ± 6 aa |
| Standard deviation of domain lengths | 6.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 45.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6PBG9 | 7-71 | KEEYISIPSHVLKDRTLSVLEALVEYLKEKQNLTYHEISILINRDERNIWTVYSRAKKKRENARK |
| A0A0B3AFN6 | 21-80 | QQSAEILLPTHIFQDRQVSVLEAISEFMKDSMGLTYHEIAVMLNRDDRTIWTCYNRAREK |
| A0A2H9PRW6 | 24-79 | None |
| A0A842VXH3 | 2-66 | None |
| A0A842UWG1 | 19-80 | None |
| A0A3M1C9I1 | 1-56 | None |
| A0A842UW61 | 85-145 | None |
| A0A832TE36 | 2-77 | None |
| A0A7J4LFT7 | 153-223 | None |
| A0A7J3LNK6 | 169-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.