DPCstruct | MC2175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 8.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7E5E6 | 1-104 | MSKQIFAHELAEIVTGLLIKPELLGELDSADRHADFLGAIAGVVADFCGGEVSMVEASRSADPIKSTVYLRVNDSLPAVCRNVWSNH… |
| A0A104Z6Q1 | 1-89 | MSKQINPQDLATIVTQLLTKPESVGQLDTDAQFKSFMTDIAQVVCNHCGGEVRHEASFLDDVCYVGIHGNDSLPEDGGIWKDYDKEG… |
| A0A071LQC5 | 1-106 | None |
| A0A7X1WIK9 | 52-146 | None |
| A0A2R7P425 | 1-93 | None |
| A0A4U0GFD7 | 1-104 | None |
| A0A2T5R4G6 | 4-84 | None |
| C5T034 | 1-109 | None |
| A0A5C7S0K5 | 1-97 | None |
| A0A2I8P006 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.