DPCstruct | MC21746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 136 ± 23 aa |
| Standard deviation of domain lengths | 23.18 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.16 |
| Pfam Score | 87.31 |
| Assigned Pfam label(s) | CL0376- PF12631- CL0329- CL0289 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D9F445 | 2-97 | AVIRTSGSASGAALRSLTGQQELPWPRAVTLRRIHDPSSMETLDRGLVIWFPGPHSFTGEDCSELHVHGGPAVVGSVLQALGLLPGL… |
| A0A517P6E4 | 4-116 | RPTAALLTPPGRGAVAVIRVVGPPTLCDAAFAAANGRPVSAQPLNRVAFGRWGRDESERRPGEELIVVRTAADETEIHGHGGRAAID… |
| A0A1L8ZDU3 | 2-114 | None |
| A0A836ASJ3 | 2-124 | None |
| A0A5M9N106 | 1-151 | None |
| A0A060ZIK5 | 56-156 | None |
| A0A1G1DJ46 | 5-157 | None |
| A0A7V4J2E5 | 1-144 | None |
| A0A7V8VGQ9 | 3-112 | None |
| A0A388KNV0 | 643-797 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.