DPCstruct | MC21742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 979 |
|---|---|
| Mean domain length (aa) | 156 ± 33 aa |
| Standard deviation of domain lengths | 32.99 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.14 |
| Pfam Score | 61.55 |
| Assigned Pfam label(s) | CL0023- CL0382- PF14214- CL0378- CL0530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A0MA63 | 2-98 | VAWFPGSRADAPRPFQPGALPDHESAFAMTVHKAQGSEFDEVWLQLPAVDNRVLSRELLYTAATRARRRLHVAGSAQVLSTALQRHV… |
| A0A2D7CU50 | 42-184 | RENNVVRDVSLKVGAKVMCLANFPQAKIWNGSQGTITDFDDDGLPIVKFSHGPEVLVEYSCYQSEKYPMLCIRQIPLCLSWALTIHK… |
| A0A7X7BSB2 | 47-218 | None |
| A0A820A9M4 | 5-92 | None |
| A0A445IYB8 | 87-200 | None |
| A0A837Q2C0 | 4-142 | None |
| A0A821UP39 | 318-478 | None |
| G0NX04 | 34-147 | None |
| G0NY74 | 169-332 | None |
| G0PHM3 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.