DPCstruct | MC21737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 178 ± 5 aa |
| Standard deviation of domain lengths | 5.19 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 72.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 27.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0241 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822DRZ8 | 1-170 | MAGMSKLPAVYRHGFVLASSMALSYWVTVKWLHERSKQLLAKDINSSMKSHLAKKDRNVAVDKNFFRKLIILLKILVPKVFCGESLF… |
| A0A336M910 | 1-172 | MAPNISKFVNQNQNSILCAAGCVASLWILIYGRTNHKRKPLPEDQIQYCITEKKDKRQQKAHVNAEFFKQLRLLLGILIPRKWSVES… |
| A0A6J2JBI0 | 1-177 | None |
| A0A409VCH3 | 1-182 | None |
| A0A433QHW5 | 1-178 | None |
| A0A0L7R2H0 | 16-199 | None |
| A0A6A0H1Z5 | 1-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.