DPCstruct | MC21736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 72 ± 7 aa |
| Standard deviation of domain lengths | 7.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 56.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A670YCL2 | 1-71 | MKEISKHVRELLQIEEPRFERSISLPPRDNIGLFLEQKTRTGKRSDALSYSQFVQEARLQEYEPKPPTPPY |
| A0A6J8CT71 | 86-148 | GITDFEHIKMIAKSIRDLLEIEEPDWTRSISLPPRSDLGMYLEVKGNNGKNKDSLTFKNFCLN |
| A0A672JLR4 | 1-62 | None |
| A0A670HVR9 | 51-132 | None |
| T2M423 | 65-129 | None |
| A0A556TSL7 | 22-80 | None |
| A0A4W3HE67 | 28-92 | None |
| G5B677 | 109-177 | None |
| A0A6P5KB77 | 238-319 | None |
| A0A663DNX1 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.