DPCstruct | MC21734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Standard deviation of domain lengths | 13.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183R0V4 | 56-191 | VAYVNKKKCTKSPEIRLFNPLAINFEQYEKSLRNALFIIEKKLIEIIFEYIDNDSLNNLRKDVNLDKYKKWRSKLCWYQDYANILKT… |
| A0A670Y239 | 1-148 | LTTAPPQSKKIFPFAHVSNDKKCVTLLNPQAVDLDAYRKKVQEAIKIYERRLDQIVWKALPQKEKEKFEQDQPVSYVDRKESLLEAL… |
| A0A7M4EYN7 | 47-166 | None |
| A0A2J8J6S3 | 377-500 | None |
| A0A493TVL6 | 13-135 | None |
| A0A1I8H068 | 509-659 | None |
| A0A3B3QND5 | 854-980 | None |
| A0A835NWE4 | 437-571 | None |
| A0A4W3JH64 | 2-119 | None |
| A0A226MQG1 | 2-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.