DPCstruct | MC21731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 122 ± 10 aa |
| Standard deviation of domain lengths | 10.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1L207 | 203-337 | LDNQIGPNVTAEHVDVKEGTADGVIRGNRFDGQGISGANSADSWVDVKGSGYLIEDNTGTFRTPGTFANGYETHNLLDGYGCGNTWR… |
| A0A0U3AMX0 | 1-108 | MKEGTTGGRVVGNVMDGAGMTGADSLVDVKGNDWVIESNVGQHAEEAMQTHRIEDGWGTGNIFRDNTVDVDGDGRHFYIHDPEITDN… |
| A0A226ELZ0 | 202-310 | None |
| A0A1Q9SX18 | 87-213 | None |
| A0A7W5JWY8 | 1100-1220 | None |
| A0A1V2Z930 | 529-651 | None |
| A0A4V2F4A5 | 375-490 | None |
| A0A6N4TBE7 | 17-134 | None |
| A0A0M8W6D3 | 797-935 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.