DPCstruct | MC2173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Standard deviation of domain lengths | 15.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H9BNA3 | 25-146 | LQQINLPDNHSVLQVAEGENEPRSIGSYSIRLYGGHNPDFPLDDFITGLIVAREGVVERVFNIDGNGDGIGEVVVVIRSAGSGGYLT… |
| A0A6B0XWP1 | 7-126 | MAPGTNVAVTVVEGPGEPRSIGSYALWTYEILDLDWLRESFAAGLVRERERTVEALLFKDVDRDVTGGVIVVVRSAGSGGYVSANVY… |
| A0A6N9AYH1 | 68-185 | None |
| A0A0H2W829 | 2-114 | None |
| A0A811ALY9 | 156-277 | None |
| A0A2N7DS96 | 50-128 | None |
| A0A3N5F2G3 | 167-292 | None |
| A0A6P2J2Y8 | 2-107 | None |
| A0A375HSY2 | 19-154 | None |
| A0A261VZR0 | 119-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.