DPCstruct | MC21729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 147 ± 23 aa |
| Standard deviation of domain lengths | 22.64 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0LZ83 | 7-137 | ADRLGINRQHCLDNLKVLRDNPQVREKVVAIFAEAEPFVPSENVDAQLYNGFFSDADRAAMNIVLQTEPRNLPALDITFADKRIEKL… |
| A0A0U2NWW7 | 2-116 | LAAHPSFGEALRTAYEMREPYAPSSDVESQLYNGFGDSKDKPKMAAVRNASPQELADFHPDFTDERLTQLLIRYRARNYPESLSDDE… |
| A0A0P9Z847 | 8-154 | None |
| A0A485D083 | 26-154 | None |
| A0A263HCL2 | 200-364 | None |
| W1HSG7 | 1-98 | None |
| G2ZNG5 | 580-750 | None |
| A0A378N6D1 | 167-305 | None |
| A0A831RZ65 | 1-140 | None |
| A0A7X6Q704 | 243-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.