DPCstruct | MC21726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 5.94 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D8KCY5 | 11-87 | RMIVRKGDMSPNTLLRLIRQDDGDMCVAIIDDEGNQTDVEFCVPGAGGGKSPNTWRGLYALAAAIEADNKEAPFRVA |
| A0A518J130 | 2-84 | RARIASREEDMSPDGKLEILMQDDGDVIVNVKPSREDPHYRGSPFGVSVEFCSVGSGGGRSIHTLKALRDLFSAIEKDNAENP |
| A0A841S2G4 | 12-85 | None |
| A0A5C9CNM6 | 4-74 | None |
| A0A1L7NMI8 | 1-73 | None |
| A0A7V8F4N7 | 51-130 | None |
| G0JLZ9 | 188-268 | None |
| A0A3S0F9V5 | 3-86 | None |
| A0A6N8BTS8 | 1-87 | None |
| A0A7M1L4Y8 | 363-444 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.