DPCstruct | MC21725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 262 ± 33 aa |
| Standard deviation of domain lengths | 32.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A518IWF1 | 1-306 | MRLALRTAATLMLAFALGLPGASVSAQQTLPASAEPEPISLSGLVVQSYPPKPTMIESMASARRGVCAHLRASPVCQLLDGLLRPLS… |
| A0A518GAC8 | 1-237 | MVGTKTRIAAAVLTVAMTASTMAQTVPAPPSPPTVWSFLGIPQGMKKVKGALTNRRGNHPAVEPKDALKALNDPANLESPDPAIKRA… |
| A0A5B9MDK1 | 22-279 | None |
| A0A7D8UKD6 | 1-289 | None |
| A0A518B4Y3 | 15-300 | None |
| A0A7V1Z6K6 | 3-219 | None |
| D2QZK0 | 6-265 | None |
| A0A353Z8N6 | 1-209 | None |
| A0A2D7HXE7 | 1-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.