DPCstruct | MC21723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 64 ± 7 aa |
| Standard deviation of domain lengths | 7.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 54.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820A2E0 | 1-66 | MSSSPCKGPGYASPLDAMANAPNEKIIYVSMLPCQDDQPNYLATIDVDPDSPNYQKVLHRMYFPNV |
| A0A445DKK1 | 15-72 | GPGYATPLEAMSGPRETLIYVTAVYTGTGVQKPDYLATVDIDPNSPTYSKVIHRLPVP |
| A0A1D6NW35 | 82-149 | None |
| A0A804PND7 | 7-81 | None |
| A0A674H329 | 5-63 | None |
| A0A7M4EPH0 | 13-69 | None |
| A0A2I0T9G0 | 10-81 | None |
| A0A844MNL5 | 1-66 | None |
| A0A670ZK71 | 3-64 | None |
| A0A669QI95 | 2-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.