DPCstruct | MC21722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 171 ± 18 aa |
| Standard deviation of domain lengths | 18.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803J3P5 | 16-149 | PVGAGTQVCESCPGALRNSSQVSQLCRAAPKARTLGRCCLGHMDGSDVIIGLDLWNCSLAQLDPTLHLTQAAVVLDLSSNPLRDLPS… |
| A0A803WA24 | 25-211 | VRGVALLLLPLLLLPRAARGAAVCGLCPGPPRNGSIVSRFCESRGGTESDGRCCRERGPSPGRLLGLDLSNCSLHSVPPGLAEATTA… |
| A0A1Y3ERS6 | 1-175 | None |
| A0A817YM77 | 24-184 | None |
| A0A7I8VDU6 | 169-344 | None |
| A0A6J3JRT7 | 25-182 | None |
| A0A813YC08 | 11-185 | None |
| A0A670HZ39 | 21-187 | None |
| H0ZXG0 | 229-426 | None |
| A0A3Q2UL78 | 355-488 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.