DPCstruct | MC21718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 167 ± 15 aa |
| Standard deviation of domain lengths | 15.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A2F211 | 80-241 | LNEIRQDVNSLKVDVGALKVDVNNLKSEMGCLKSESGDTKRKIDHVMNAISCGPTSSAVGLIQSHSPISLTEEGKNVARKINAEEII… |
| A0A845DBN9 | 21-177 | LVVLVVLSALSRFIWKDNGLTTAFMAGCFLALITLFKHFMESGSFESIYQWQSNHLIVEHQRNVKETKSPITLNKEGTETIEKLRGR… |
| A0A2H0B7N5 | 10-203 | None |
| A0A410VEW5 | 2-153 | None |
| A0A2U7P2P4 | 1-182 | None |
| A0A7T9F3J2 | 1-151 | None |
| A0A1G2LDE6 | 5-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.