DPCstruct | MC21712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 139 ± 11 aa |
| Standard deviation of domain lengths | 11.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1NX24 | 34-191 | RITFTNSHGDMTVTAGKGFERSYTWAGGTRSLVMWPRKERWYGSLGMYNPGAYIEGELEQWKEHDGIKRCVAEEGQRHFTNTTDAVA… |
| A0A254QG46 | 247-389 | IIEATTPKGTIKIEAGPMRKRSYTWEGATRSVIMYPRTGERWYGSLGLYYPGPGNHWEEHNGISRCVVEEGQQHFKSVSEAMKWLKE… |
| A0A2G6EWI6 | 2-142 | None |
| A0A4Q2XBD5 | 221-359 | None |
| A0A3E1ETW8 | 138-277 | None |
| A0A354TJP2 | 1-113 | None |
| A0A838QWE0 | 2-130 | None |
| A0A1V6IY69 | 33-169 | None |
| A0A318ILX0 | 44-191 | None |
| A0A845GKQ5 | 48-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.