DPCstruct | MC21710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 89 ± 5 aa |
| Standard deviation of domain lengths | 4.80 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7MZM3 | 15-98 | HPLDRPEAWRRADAWYTRTTGGRPVLLSVESFDHGFIARPAIPPPEAPDHVLIIDRDTAALTLWPAYATDTLATQYGRYRRGEL |
| A0A2T0S1E5 | 2-87 | ITLAEAEEIAAGWARGESERRGYECTPMVSEFDLGFVVWTKQPSSVLPIPGDGVRTVIDRETGAVSTFPGVPVAVVADLYRQQQPE |
| A0A197SUJ7 | 1-85 | None |
| A0A1T3NWQ2 | 152-247 | None |
| A0A7K2RTI9 | 2-90 | None |
| A0A6B1K2P7 | 1-96 | None |
| A0A0D4DTR2 | 21-107 | None |
| A0A543ID96 | 1-96 | None |
| A0A545AR70 | 52-146 | None |
| A0A1D3DUB9 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.