DPCstruct | MC21708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 176 ± 43 aa |
| Standard deviation of domain lengths | 43.35 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 84.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E2S178 | 20-251 | QCSLCGGIRATKTREHFPPTNFFDQFHRPEQFVVPACDNCNRGTGVADLLAGIMARIGFGEPTAQELDDNKKLMRKLRSLRPDFYAK… |
| A0A7Y0D5G6 | 34-200 | SCILAGTTDPAKQKNLNFQRALARNRSLLKRIENSKEIYLPKGEDESKTIWHPENDRINRVVLKNARGHAYFEFGEPIPDEPDYVWA… |
| A0A4R7QAM9 | 145-378 | None |
| A0A655TUF6 | 11-166 | None |
| A0A265QCS8 | 2-115 | None |
| A0A2V5YW61 | 5-152 | None |
| A0A850R8E9 | 5-226 | None |
| B3DXH6 | 17-219 | None |
| A0A4Q3P251 | 12-174 | None |
| A0A2T3NPU0 | 63-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.