DPCstruct | MC21703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 92 ± 7 aa |
| Standard deviation of domain lengths | 7.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 32.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848TU53 | 3-89 | HIAYNWIRRDIGGDTQRINHADIKLSDETFKHILLPVYISSYKYNGKEFHFYINGQTGTLSGTRPYSFWKIFFLVLFIIVVIVLIAI |
| A0A7C1P3T7 | 1-101 | MLPMDPLIRMAVERDIGGDEQIINTMNVTYRDITFKHLLLPIWISAFKFKDKVYRFLVNARTGEVQGERPWSWLKILLAALATAAVI… |
| A0A3D5N1Q0 | 43-141 | None |
| A0A7C6ZZJ4 | 56-155 | None |
| A0A800JEF7 | 131-218 | None |
| W4V5B5 | 36-134 | None |
| F5UFX3 | 127-213 | None |
| A0A645EUK5 | 36-131 | None |
| K1TLB6 | 1-77 | None |
| A0A7Y4ZLW7 | 53-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.