DPCstruct | MC217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 287 ± 24 aa |
| Standard deviation of domain lengths | 24.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423JUU5 | 254-523 | LATSVEGIQMELNHQEPALITGVDSQWVRERADALTDHLKALVDSTQRCAPLLNVAHPRGLRWFVSSSGRLIDTGNVLHPDSTVAVG… |
| G2H2B9 | 4-287 | NGCILDIKLQNDAFIATLFGCTPRFSDADDRSRAGMMINRGELERALTTFCSLYSCPEIIMIRLKNRGYGWFHPASSALFTLPIEAS… |
| A0A2R7RJH1 | 740-1009 | None |
| A0A7Y4A1R9 | 50-303 | None |
| A0A6L2ZQM4 | 2-250 | None |
| A0A6L2ZMS7 | 644-930 | None |
| A0A2U8I5X1 | 823-1167 | None |
| A0A2U8I2F3 | 303-604 | None |
| E0WUM3 | 70-382 | None |
| A0A2R7KGN9 | 967-1245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.