DPCstruct | MC21696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 136 ± 26 aa |
| Standard deviation of domain lengths | 26.43 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H1QPV3 | 2-122 | RRDEGPVRQRFPELGDVAGAEWTGEVLGSGRPSVPGPTDVRMSGVVRLTDADASRLSEEYVWQDGPGAPVVSSLLRARVPQSTRWQT… |
| A0A2S8KTD5 | 1-108 | MTKRFPAIGVPEAVAWVTWTNASRDVPGPTTYWIDAVITLHPQAAAALARDTTAEGRMPDVAEALRSAVGPGPFVTGAALNEALSTD… |
| A0A0Q8Q6W5 | 29-154 | None |
| X8E0Y1 | 2-123 | None |
| A0A419YCF9 | 18-168 | None |
| A0A652LFI2 | 5-148 | None |
| A0A1Q6ND64 | 25-159 | None |
| A0A0D0Q670 | 2-124 | None |
| A0A7Z0TH24 | 4-131 | None |
| A0A421AV95 | 15-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.