DPCstruct | MC2169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 146 ± 26 aa |
| Standard deviation of domain lengths | 26.23 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H3MV50 | 58-171 | EDLQPLKEILKDVNILGMGEATHGTKEFFEMKHRMFEFLVEEMDYKAFAIEAEFGCHKIINDYILHGEGDIEKVIKSMKFWTWSTQE… |
| A0A429X349 | 3-152 | NFVREKTRNRWKEQIKRTASEIKEGNDFSFIEHFIKDKRIILLGENSHGIADYFTIKTDLIRYLHQYHEFHVVVLESGLLEATLCKQ… |
| A0A3F2TZ19 | 5-111 | None |
| A0A7M5X1A2 | 6-180 | None |
| A0A0B5RXN8 | 8-138 | None |
| A0A3C0S3F7 | 54-204 | None |
| A0A5B1B444 | 127-256 | None |
| A0A094GSH5 | 29-162 | None |
| A0A829YGZ9 | 623-756 | None |
| A0A1H0B229 | 19-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.