DPCstruct | MC21687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 109 ± 29 aa |
| Standard deviation of domain lengths | 28.68 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 92.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 45.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428TFE9 | 16-113 | KPFMMGVSPSFYVNLAEWNKNWYSSSESLWYDRWLQVLDVLPDSIEIITWNDFSESSYIADIVPSQIVRGAEVYVDGHEHSALRSLL… |
| A0A1V1T2I4 | 103-198 | PVSPWFFTHFGPEVPYSKNWVFPSDTLWFDRWQQILELQPEYIEIVTWNDYGESHYIGRLDSPHGDDGSSKWVYGFPHDAFLDMAIP… |
| A0A4Q2DN98 | 599-693 | None |
| K9FVE2 | 119-213 | None |
| A0A1V6PEC2 | 135-230 | None |
| K5W2N1 | 120-217 | None |
| A0A0G2EUY3 | 1002-1174 | None |
| A0A5N5WJR0 | 167-346 | None |
| T0LVD0 | 1-171 | None |
| A0A5B0QQ42 | 125-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.