DPCstruct | MC21683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 112 ± 20 aa |
| Standard deviation of domain lengths | 20.32 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.99 |
| Pfam Score | 93.33 |
| Assigned Pfam label(s) | CL0439- PF07009 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5XSD5 | 1-81 | MIVQVVHNNEVIIEFDPDKDAVYKFTGSYGHMEVEVKDGMWRVTNEECPNHICSGVGWVSKDSYIPIICIPNEVYVAVKPE |
| F7YY87 | 7-112 | IFVFLFVFAIFFVFLLFRTNASIEFVEVLKDGKLIMRIHHPGVYEVFDDGRYVMKVVFENGKVWVEEADCPNKLCEKIGKIGAGGVI… |
| O67757 | 48-130 | None |
| A0A7X8W620 | 51-206 | None |
| A0A2V2ERL7 | 2-136 | None |
| A0A2V2GJX9 | 259-401 | None |
| A0A0F2IZY3 | 16-119 | None |
| I5AVS7 | 5-121 | None |
| C2KW61 | 33-173 | None |
| A0A829EZP3 | 413-534 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.