DPCstruct | MC21682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 333 |
|---|---|
| Mean domain length (aa) | 240 ± 47 aa |
| Standard deviation of domain lengths | 46.98 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.37 |
| Mean intra-cluster sequence similarity (%) | 11.73 |
| Pfam Score | 95.48 |
| Assigned Pfam label(s) | PF00082- PF02464- CL0422- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4PIL1 | 67-320 | VTISQYPYSAAVSTMSVRVPDFSNIKVNGDFQVQIFGTYGSNSVYVYGPNEAVRGTIIEVRGNTLCVDQARKVTGNMRNVIVRIGVN… |
| F7YXU3 | 3-222 | KFSLDFSDVRKLIVKSLSSDVQISSSQMEYSVTGPEKDLLIEKKNGTLEISVTGRGMIPIFNHDSTPISLTIPTQLDEIIVTTISGD… |
| A0A136LGY9 | 15-201 | None |
| A0A2R3MYE8 | 39-338 | None |
| A0A0Q0XJ53 | 29-185 | None |
| A0A7D7KYQ7 | 58-261 | None |
| A0A4Y4D957 | 98-320 | None |
| A0A2G6H4V3 | 22-230 | None |
| A0A7Y4XP72 | 296-488 | None |
| A0A7C0W8I8 | 22-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.