DPCstruct | MC21681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Standard deviation of domain lengths | 8.53 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 39.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M8N776 | 1-75 | MNKHYQKWDEYAPRGLLLVGFGLSVLGSAIISRAQGKGFFNWFFKGLIGLIATNAGLSIFAEAVKERTLYELDVQ |
| A0A5N1JR26 | 1-90 | MSTRTKWLLLAPFSLILIGYGLCVFSEAANLKHTGEPFSRWFLLGTYSLVVINAGLSLFGQAIIFRMQIENRRTIRRYLKKMLRERL… |
| A0A511R1K9 | 1-71 | None |
| A0A651EBZ6 | 4-71 | None |
| A0A267TEF5 | 18-109 | None |
| A0A2M8NMD7 | 1-75 | None |
| A0A2N4XF51 | 16-103 | None |
| A0A7C9BEE8 | 18-103 | None |
| A0A431U3E3 | 1-72 | None |
| A0A2E3QYY2 | 17-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.