DPCstruct | MC2168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 227 ± 25 aa |
| Standard deviation of domain lengths | 25.48 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4I6X4 | 17-270 | ADQKLKEARALVKEGHLENALEAYLFAFDNSRFVSGWGGVRLSYIPNEIAAMGKKFPLAITALKERRDMRERLILDGETDYDLVAEW… |
| A0A7Y2K2L2 | 1-228 | MDARERLDAASELAGDGQYEEALREFQWFHDHALEEDLSLYGVRLSYALYAWVELGAEYPPALAALEAVRERDAALLLAGTGKRQLF… |
| A0A518K643 | 211-420 | None |
| A0A5C5ZLI6 | 38-252 | None |
| A0A7D8UI83 | 39-327 | None |
| A0A7D8UEW8 | 77-311 | None |
| A0A4V1ATG0 | 2-188 | None |
| A0A2A4QJN1 | 149-377 | None |
| A0A7W1ZSL6 | 146-356 | None |
| A0A354IPW2 | 4-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.