DPCstruct | MC21679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 197 ± 27 aa |
| Standard deviation of domain lengths | 27.15 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A373BPI2 | 2-147 | ILAASYLSNPKEIDEAELLFTQLESELQDRIDHIENAYPGYDEYTYNLDEIGHNPFTLINYLSAVHTEFTAAGVEQEIQELFQQMYT… |
| A0A6N4AMW0 | 219-410 | AVIAGIKAIAAAIAAGGWIAVLIILIVCLLALILGSVFGIFFSGEDKSSGMSIQTVMQEIDTEYENRLSEIKESNTYDVIEMSGSKA… |
| F9MUD9 | 46-249 | None |
| A0A4V4RY85 | 724-914 | None |
| A0A845RFV0 | 8-177 | None |
| A0A1C5NIZ0 | 209-416 | None |
| A0A1Y3RT68 | 196-378 | None |
| A0A414RAP5 | 345-516 | None |
| A0A381I7L3 | 291-463 | None |
| V2Z637 | 182-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.