DPCstruct | MC21677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 248 ± 30 aa |
| Standard deviation of domain lengths | 29.92 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0SZI6 | 1-270 | MSTEEPSKCCVCGEGTTKRCQACAKHGIHLFFCSPEHQKLVWKHHKQVCGPNAHPLSPPACSDDELRDLLAHGRHPRALPAGTLGCV… |
| A0A061BDQ6 | 21-297 | VPGTSSTTQAHATATDGPEREGGMTKCCVCGLATDKRCQACAKSRIALFFCSPEHQKLVWKHHKHVCGPNAHPFHFPPLSQREVDEL… |
| M7WEC7 | 1-321 | None |
| M7WKD7 | 7-224 | None |
| M7WWG1 | 1-245 | None |
| A0A5C5G011 | 1-233 | None |
| A0A109FFV7 | 2-205 | None |
| A0A4U0VVI7 | 3-267 | None |
| A0A4U0WAD1 | 1-226 | None |
| G0SZ58 | 1-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.